DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F3 and Cyp316a1

DIOPT Version :9

Sequence 1:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens
Sequence 2:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster


Alignment Length:455 Identity:116/455 - (25%)
Similarity:197/455 - (43%) Gaps:67/455 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    89 CWWVGPWHAIVRIFHPTYIKPVLFAPAA-------IVPKD---KVFYSFLKPWLGDGLLLSAGEK 143
            ||          :||.      ||.|.|       ::..|   :..|..:|.||..|:|:...|:
  Fly    71 CW----------VFHR------LFIPLADLELSRQLLENDTHLETGYELMKDWLVGGVLMCQSEQ 119

Human   144 WSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARL-DMFEHISLMTLDSLQKCV 207
            |.:...:::..|....|:..:.:.......:   .|.||.:...:: |::..:|.:.||.:..  
  Fly   120 WQKRHSLISGLFDKGNLEQLIDLSRHQTEQL---LQKLAKQADQKVFDIWYTVSPIVLDLMVM-- 179

Human   208 FSFDSHCQEKPS-EYIAAILELSALVTKRHQQILLYIDFLYYLTPDGQRFRRACRLVHDFTD--- 268
                :.|..||| ||...:.:||.:..||...:.....|.|:|:....| :|..||:....|   
  Fly   180 ----TTCGAKPSEEYSKNLKDLSEIYRKRFLSLQSANRFNYWLSSPFMR-KRQNRLIKRLNDEHN 239

Human   269 ---AVIQERRRTLPSQGVDDF-LQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEG 329
               |:.|.:.:.....|:|.: |:..........:::||.|||   .:|:.|:|..|.:|..:.|
  Fly   240 NLMAMHQSQNQLKIENGLDIYQLRPIPLKDHKSLLEILLESKD---PQLTGEEICGELNTCNYLG 301

Human   330 HDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPP 394
            :...:..|.:.|..:|::|..|::|..|    |...:.|:..| ||.:|.:|...:.|::||:||
  Fly   302 YQLCSPALCFCLVTIARNPSVQQKCLDE----LNLAQIKDQGW-DLEKLNYLDAVLHETMRLYPP 361

Human   395 VPAVSRCCTQDI-----VLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRF-DPKNIKER 453
            ...|.|...:|.     ::.|.. :|.|....|:::....|...:|....:|..|| |       
  Fly   362 QVIVGRQLKKDFPYTHSIVGDAE-LPCGSEIYINLYELQRNEVRYPKANHFDAQRFLD------- 418

Human   454 SPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFRVLPDHTEPRRKPELVLRAEGGLWLRVEP 518
            ||...:.:|.|||.|..:.|:|..:|.:|...|..|.|||...|.|....|||.:..|..|.::|
  Fly   419 SPPELLSYSLGPRCCPARKFSMQLLKTLLAPILANFEVLPYGDEVRLDLRLVLGSSNGFQLALKP 483

Human   519  518
              Fly   484  483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F3NP_000887.2 p450 52..515 CDD:365848 114/450 (25%)
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 110/436 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.