DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F3 and Cyp9c1

DIOPT Version :9

Sequence 1:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens
Sequence 2:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster


Alignment Length:397 Identity:93/397 - (23%)
Similarity:173/397 - (43%) Gaps:51/397 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   132 LGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFN----ESVNIMHAKWQLLASEGSARLDMF 192
            :...||.....:|.:.|..|||.|....::...::.:    |:|:.:    |.....|::.|::.
  Fly   119 ISKSLLSLRDRRWKQMRSTLTPTFTSLKIRQMFELIHFCNVEAVDFV----QRQLDAGTSELELK 179

Human   193 EHISLMTLDSLQKCVFSFDSHCQEKP-SEYIAAILELSALVTKRHQQILLYI------------- 243
            :..:..|.|.:....|....:..:.| :|:.:....:|........:::|||             
  Fly   180 DFFTRYTNDVIATAAFGIQVNSFKDPNNEFFSIGQRISEFTFWGGLKVMLYILMPKLMKALRVPV 244

Human   244 ------DFLYYLTPDGQRFRRACRLVH-DFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDV 301
                  |:...|.....::|:...:|. |....:::.:|:....|      :..|:|        
  Fly   245 MDMNNVDYFKKLVFGAMKYRKEQSIVRPDMIHLLMEAQRQFKAEQ------EGSAES-------- 295

Human   302 LLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDRE 366
               :..:|..:.:|:|:.|:...|...|.:|.|:.||:..|.|..:||.||:...|:..:.:...
  Fly   296 ---AAQQDKAEFNDDDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEILAVKEQLG 357

Human   367 PKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPD--GRVI---PKGIICLISVFG 426
            .|.:::|.|..:.:|...:.||||..||...|.|.|..|..|.|  |.|:   .:..:..|:|..
  Fly   358 EKPLDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKDEEGEVVVNLREDDLVHINVGA 422

Human   427 THHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFRV 491
            .||:|..:|:||.:.|.|||.::..|.....::||..|.|:|||...|:.|:|.::...:||:.:
  Fly   423 LHHDPDNFPEPEQFRPERFDEEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSLIFQLVLRYHL 487

Human   492 LPDHTEP 498
            .|....|
  Fly   488 KPTDRTP 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F3NP_000887.2 p450 52..515 CDD:365848 93/397 (23%)
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 93/397 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.