DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F3 and Cyp4aa1

DIOPT Version :9

Sequence 1:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens
Sequence 2:NP_611067.2 Gene:Cyp4aa1 / 36752 FlyBaseID:FBgn0034053 Length:510 Species:Drosophila melanogaster


Alignment Length:534 Identity:160/534 - (29%)
Similarity:261/534 - (48%) Gaps:87/534 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    20 LLLLLVGASWLLARILAWTYTFYDN----------CCRLRCFPQPPKRNWFLGHLGLIHSSEEGL 74
            |:||::..|         .||||..          ..||...|..|    |||:..|:...:   
  Fly    19 LILLVISLS---------IYTFYATLNTYLRSVLLSLRLTGPPSLP----FLGNCMLVTDKD--- 67

Human    75 LYTQSLACTFGDMCCWWVGPWHAIVRIFHPTYIKPVLFAP--AAIVPKD------------KV-F 124
            |..:.....| |:       :.::|||:       ||..|  |.:.|:|            || |
  Fly    68 LMRRCAGKAF-DL-------YGSLVRIW-------VLLFPFFAVLEPEDLQVILSSKKHTNKVFF 117

Human   125 YSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEG-SAR 188
            |..:..:|||||:.|:|.|||.|||::.||||.|:|:.::..|   |:...:.::.|.:|. ...
  Fly   118 YRLMHNFLGDGLITSSGSKWSNHRRLIQPAFHHNLLEKFIDTF---VDASQSLYENLDAEAVGTE 179

Human   189 LDMFEHISLMTLDSLQKCVFSFDSHCQEKPSEYIAAILELS------ALVTKRHQQILLYIDFLY 247
            :::.::::...||.|.:.|.....    |......|::|.|      .::..|..|..|.:|.:|
  Fly   180 INIAKYVNNCVLDILNEAVLGVPI----KKRGQDVAMMEDSPFRQGKIMMPARFTQPWLLLDGIY 240

Human   248 YLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKK 312
            :.|..........:.::|||..:||.||:      :.:.....::.|.|  :| .::...|..:.
  Fly   241 HWTKMANDELNQKKRLNDFTRKMIQRRRQ------IQNNNNGNSERKCL--LD-HMIEISESNRD 296

Human   313 LSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKD--REPKEIEWDDL 375
            .::|||..||.|||..|.|:..:.:::.|:.|.::||.|:||..|:..:.:|  |.|   ...||
  Fly   297 FTEEDIVNEACTFMLAGQDSVGAAVAFTLFLLTQNPECQDRCVLELATIFEDSNRAP---TMTDL 358

Human   376 AQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVY 440
            .::.::.|||||:|||:|.||.::|...:::.|.. ..:|.|....|..:.||....::||||.:
  Fly   359 HEMRYMEMCIKEALRLYPSVPLIARKLGEEVRLAK-HTLPAGSNVFICPYATHRLAHIYPDPEKF 422

Human   441 DPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFRVLP--DHTEPRRKPE 503
            .|.||.|:|.:.|.|.||:|||||||.|||..||:.|:|.::...|..:::||  ..|.......
  Fly   423 QPERFSPENSENRHPYAFLPFSAGPRYCIGNRFAIMEIKTIVSRLLRSYQLLPVTGKTTIAATFR 487

Human   504 LVLRAEGGLWLRVE 517
            :.|||.||||:|::
  Fly   488 ITLRASGGLWVRLK 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F3NP_000887.2 p450 52..515 CDD:365848 149/488 (31%)
Cyp4aa1NP_611067.2 p450 50..475 CDD:278495 139/466 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154688
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.