DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F3 and Cyp6a19

DIOPT Version :9

Sequence 1:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens
Sequence 2:NP_611001.2 Gene:Cyp6a19 / 36662 FlyBaseID:FBgn0033979 Length:503 Species:Drosophila melanogaster


Alignment Length:528 Identity:149/528 - (28%)
Similarity:247/528 - (46%) Gaps:65/528 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    20 LLLLLVGASWLLARILAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSE--EGLL---YTQS 79
            ||.|:||...|:|..:...||::    :.|..|..|. |..||:.|.:..:.  .|:|   |.:.
  Fly     4 LLGLVVGVLTLVAWWVLQNYTYW----KRRGIPHDPP-NIPLGNTGELWRTMPLAGILKRTYLKF 63

Human    80 LACTFGDMCCWWVGPWHAIVRIFHPTYIKPVLFAPAAIVPKDK-----VFYSFLKPWLGDGLLLS 139
            ...|.|....:::.....|| |....::|.||     |...||     |:::.....|.:.|...
  Fly    64 RKQTDGPFAGFYLYAMKYIV-ITDVDFVKTVL-----IRDFDKFHDRGVYHNEKDDPLTNNLATI 122

Human   140 AGEKWSRHRRMLTPAFHF----NILKPYMKIFNESVNIMHAKWQLLASEGSARLDMFEHISLMTL 200
            .|:||...|:.||..|..    ::....:.:.:|.:.::..|    .|..|..|::.:.:|..|.
  Fly   123 EGQKWKNLRQKLTHTFTSAKMKSMFSTVLNVGDEMIRVVDEK----ISSSSQTLEVTDIVSRFTS 183

Human   201 DSLQKCVFSFDSHCQEKP-SEYIAAILELSALVTKRHQQILLYIDFLYYLTPDGQRFRRACRLVH 264
            |.:..|.|....:....| :|::.  :..|||..:||..:   :|.|.:..|     :.|.:|..
  Fly   184 DVIGICAFGLKCNSLRDPKAEFVQ--MGYSALRERRHGWL---VDLLIFGMP-----KLAVKLGF 238

Human   265 DFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLLLSK---DEDGKK--LSDEDIRAEADT 324
            .|....:|:....:....:|  .:.|.|....||:|.|:..|   |:..|:  |:..::.|:|..
  Fly   239 QFLLPSVQKFYMKIVQDTID--YRMKRKVTRNDFMDTLIDMKQQYDKGDKENGLAFNEVAAQAFV 301

Human   325 FMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCIKESL 389
            |...|.:..::.:.:.||.||.:.:.|::.|.|:..:| :|...::|:|.:..|.::...|.|||
  Fly   302 FFLAGFEAGSTTMGFTLYELACNQDVQDKLRAEIDSVL-ERYNGKLEYDSMQDLFYMEKVINESL 365

Human   390 RLHPPVPAVSRCCTQDIVLPDGRVIPK-----GIICLISVFGTHHNPAVWPDPEVYDPFRFDPKN 449
            |.||.|..::|..|:    |.....||     |...|:|..|.||:|..:|:||.:.|.|||.:.
  Fly   366 RKHPVVAHLARIATK----PYQHSNPKYFIEAGTGVLVSTLGIHHDPEFYPEPEKFIPERFDEEQ 426

Human   450 IKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLL----RFRVLPDHTEPRRKP--ELVLRA 508
            :|:|...||:||.||||||||..|  ..|:|::||.||    ||.:.|....|.:..  .|:|.:
  Fly   427 VKKRPTCAFLPFGAGPRNCIGLRF--GRMQVIIGLALLIHNFRFELHPKTPVPMKYTINNLLLGS 489

Human   509 EGGLWLRV 516
            |||:.|.:
  Fly   490 EGGIHLNI 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F3NP_000887.2 p450 52..515 CDD:365848 138/493 (28%)
Cyp6a19NP_611001.2 p450 32..495 CDD:278495 138/492 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.