DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F3 and Cyp6a23

DIOPT Version :9

Sequence 1:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens
Sequence 2:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster


Alignment Length:554 Identity:139/554 - (25%)
Similarity:234/554 - (42%) Gaps:112/554 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    20 LLLLLVGASWLLARILAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF 84
            |:.|||.....:||                      :|:.:....|:.|.....:         :
  Fly     7 LIALLVSLLLFMAR----------------------RRHGYWQRRGIPHDVPHPI---------Y 40

Human    85 GDMCCWWVGPWHAIVRIFHPTYIK------P-----VLFAPAAIVP----------KD------- 121
            |:|..|  .....|..||...|.|      |     ..|..:|::.          ||       
  Fly    41 GNMKDW--PKKRHIAMIFRDYYTKYKRSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENR 103

Human   122 KVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHF----NILKPYMKIFNESVNIMHAKWQLLA 182
            .:||:.:...|...|....|:||...|..|||.|..    |:....:|:..|...|..||  ...
  Fly   104 GIFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAK--TTT 166

Human   183 SEGSARLDMFEHISLMTLDSLQKCVFSFDSHCQEKP-SEYIAAILELSALVTKRHQQILLYIDFL 246
            .||.. |::.:.::..|.|.:..|.|..:.:..:.| :|::.  :...|::.:|:..:|   |||
  Fly   167 GEGQV-LEIVDLVARYTADVIGNCAFGLNCNSLQNPNAEFVT--IGKRAIIERRYGGLL---DFL 225

Human   247 YYLTPDGQRFRRACRL------VHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLL-- 303
            .:..|   :..|..||      |.||..:::   |.|:      |: :.:...|..||:|.|:  
  Fly   226 IFGFP---KLSRRLRLKLNVQDVEDFYTSIV---RNTI------DY-RLRTNEKRHDFMDSLIEM 277

Human   304 -----LSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLK 363
                 ....|||  ||..:|.|:|..|...|.:|:::.:.:.||.||...:.|::.|.|:..:| 
  Fly   278 YEKEQAGNTEDG--LSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVL- 339

Human   364 DREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGR-VIPKGIICLISVFGT 427
            .:...|..::.:.::.:|...:.|:||.:|.:..::|....|....|.: .|.||...:|...|.
  Fly   340 SKHNNEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGI 404

Human   428 HHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLL----R 488
            |::|.::|:||.:.|.||..:.|..|....::||..|||||||..|.:  |:..:||..|    :
  Fly   405 HYDPEIYPEPEKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRFGL--MQACVGLAYLIRGYK 467

Human   489 FRVLPDHTEPRR--KPELVLRAEGGLWLRVEPLS 520
            |.|..:...|.:  ...::|.||.|:.|:||.||
  Fly   468 FSVSTETQIPMKFVVKSILLSAENGIHLKVEKLS 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F3NP_000887.2 p450 52..515 CDD:365848 128/515 (25%)
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 125/495 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.