DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F3 and Cyp4p2

DIOPT Version :9

Sequence 1:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens
Sequence 2:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster


Alignment Length:381 Identity:130/381 - (34%)
Similarity:206/381 - (54%) Gaps:19/381 - (4%)


- Green bases have known domain annotations that are detailed below.


Human   123 VFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIF-NESVNIMHAKWQLLASEGS 186
            |.|:||.|:|..|:|.:..:||...|.|||..||.:||..:.:|| .||:..: :::|   .:..
  Fly   118 VIYNFLHPFLRTGVLTATEKKWHTRRSMLTRTFHLDILNQFQEIFIAESLKFV-SQFQ---GQNE 178

Human   187 ARLDMFEHISLMTLDSLQKCVFSFD-SHCQEKPSEYIAAILELSALVTKRHQQILLYIDFLYYLT 250
            ..:.:.:.||..||:|:.:...... ....||...|.|....:...:|:|....|.:.|.:|.:.
  Fly   179 VVVSLKDRISRFTLNSICETAMGIKLDEMAEKGDRYRANFHIIDEGLTRRIVNPLYWDDCVYNMF 243

Human   251 PDGQRFRRACRLVHDFTDAVIQERRRTL--------PSQGVDDFLQAKAKSKTLDFIDVLLLSKD 307
             .|.::..|.::||:|:..:|.:||..|        .:|..||.: ...:.|....:|.|:.: :
  Fly   244 -TGHKYNAALKVVHEFSREIIAKRRVLLEEELENRRATQTADDDI-CVIRKKRFAMLDTLICA-E 305

Human   308 EDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEW 372
            :|| .:.|..|..|.||.|.||:|||:.||.:.|.:::.:...||.|.||:||.:.| :...:..
  Fly   306 KDG-LIDDIGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAEQELCYQEIQEHILD-DLSNLNL 368

Human   373 DDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDP 437
            ..|::|.:|...|||::||:|.:|.:.|...|:..|.:|.::||.....|.||..|.||..|..|
  Fly   369 SQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELENGLILPKRSQINIHVFDIHRNPKYWESP 433

Human   438 EVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFRVLP 493
            |.:.|.||.|:|..:|.|.|:||||||.||||||.:||.|||.::.:.|..|::||
  Fly   434 EEFRPERFLPQNCLKRHPYAYIPFSAGQRNCIGQKYAMQEMKTLMVVILKHFKILP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F3NP_000887.2 p450 52..515 CDD:365848 130/381 (34%)
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 130/381 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154876
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2076
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.