DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F3 and Cyp9b2

DIOPT Version :9

Sequence 1:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens
Sequence 2:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster


Alignment Length:469 Identity:106/469 - (22%)
Similarity:180/469 - (38%) Gaps:80/469 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    96 HAIVRIFH----------PTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRRM 150
            |.:|..|:          |..||.|........|..:.|.:.......|.|.:...::|...|..
  Fly    69 HKLVGFFNMRTPMITLNDPELIKKVCVKDFDHFPNHQPFITSNDRLFNDMLSVMRDQRWKHMRNT 133

Human   151 LTPAFHFNILKPYMKIFNES----VNIMHAKWQLLASEGSARLDMFEHISLMTLDSLQKCVFSFD 211
            |||.|....::....:.|||    :..:.:..:.|.......:||....:.::.|.:....|...
  Fly   134 LTPVFTAAKMRNMFTLMNESFAECLQHLDSSSKTLPGRKGFEVDMKVMCNKLSNDIIATTAFGLK 198

Human   212 SHCQEKPSEYIAAI--------------LELSALVTKRHQQILLYI------DFLYYLTPDGQRF 256
            .:..:.|......|              ..||.||.|....:.|.|      |:...|..:..::
  Fly   199 VNSYDNPKNEFYEIGQSLVFSRGLQFFKFMLSTLVPKLFSLLKLTIFDSAKVDYFARLVVEAMQY 263

Human   257 RRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAE 321
            |              ::...|.|                 |.|.:|:.:|:|...|.:|::|.|:
  Fly   264 R--------------EKHNITRP-----------------DMIQLLMEAKNESEDKWTDDEIVAQ 297

Human   322 ADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCIK 386
            ...|.|...:..::.:....|.|..:|:.|||..:|:.|..|......:.:|.:.::.::.|.|.
  Fly   298 CFIFFFAAFENNSNLICTTTYELLYNPDVQERLYEEIVETKKALNGAPLTYDAVQKMTYMDMVIS 362

Human   387 ESLRLHPPVPAVSRCCTQDIVL--PDGRVI---PKGIICLISVFGTHHNPAVWPDPEVYDPFRFD 446
            ||||......|..|.|::|..|  .||..:   ..|....|.:.|.|.:...:|:|..:||.||.
  Fly   363 ESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFPEPRKFDPDRFS 427

Human   447 PKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFRVLPDHTEPRRKPELVLRAEG- 510
            .:...:..|..::||..|||||||..:|:.::|.:|...||.:::   ...||...:|...|.| 
  Fly   428 EERKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKI---EASPRTIKDLWGSASGF 489

Human   511 ------GLWLRVEP 518
                  |.|:.:.|
  Fly   490 NFTPRSGFWMHLVP 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F3NP_000887.2 p450 52..515 CDD:365848 105/464 (23%)
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 99/442 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.