DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F3 and Cyp4ac3

DIOPT Version :9

Sequence 1:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens
Sequence 2:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster


Alignment Length:528 Identity:169/528 - (32%)
Similarity:260/528 - (49%) Gaps:61/528 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    19 WLLL----LLVGASWLLARILAWTYTFYDNCCRLR----------CFPQPPKRNWFLGHLGLIHS 69
            |:.|    ||:||.|||.|.|..||.....|.|:|          .|..|.|.. |..:|.|::.
  Fly     2 WIALLGSSLLIGALWLLLRQLNKTYFILSLCKRVRTADGSPLESKVFVVPGKTR-FGNNLDLLNL 65

Human    70 SEEGLL--YTQSLACTFGDMCCW--WVGPWHAIVR------IFHPTYIKPVLFAPAAIVPKDKVF 124
            :...:.  ..:|.|...|....|  ...|.:.|||      ||..|.|           ....:.
  Fly    66 TPANIFSYIRESTAKANGQNYIWNFLFAPEYNIVRAEDAEEIFQSTKI-----------TTKNMS 119

Human   125 YSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKW-QLLASEGSAR 188
            |..::|:||||||:|..:||...|:.||||||||||:.::.||.|.    ..|: ::|.......
  Fly   120 YELIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEE----SKKFIKILDKNVGFE 180

Human   189 LDMFEHISLMTLDSLQKCVFSFDSHCQEKPSEYIAAILELSALVTKRHQQILLYIDFLYYLTPDG 253
            |::.:.|...||:::.:...........:.:||..||.:...:..:|....|::.::.::|..|.
  Fly   181 LELNQIIPQFTLNNICETALGVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDY 245

Human   254 QRFRRACRLVHDFTDAVIQERRRTLPSQ---GVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSD 315
            :::.|..|.:|.|:..:||.:|:....:   .||:|    .|.:....:|.||.::.|.  |:..
  Fly   246 KKYSRILRTIHGFSSGIIQRKRQQFKQKQLGQVDEF----GKKQRYAMLDTLLAAEAEG--KIDH 304

Human   316 EDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPF 380
            :.|..|.:||||.|:|||::.|.:.|..||.|.:.||||.:|:|:|.:|.:  |:......:|..
  Fly   305 QGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDID--EVSMFQFNELIH 367

Human   381 LTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRF 445
            |...|||||||.|..|.:.|.|.::.|: :|.|:||.....|.::....:...:|.|..:.|.||
  Fly   368 LECVIKESLRLFPSAPIIGRTCIEESVM-NGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERF 431

Human   446 DPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFRVLP-DHTEPRRKPELVLRAE 509
            .|:|...|.|.||:||||||||||||.|.:.|:||:|...:..|::|| ...|.       |..|
  Fly   432 LPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLPATQLED-------LTFE 489

Human   510 GGLWLRVE 517
            .|:.||.:
  Fly   490 NGIVLRTQ 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F3NP_000887.2 p450 52..515 CDD:365848 150/477 (31%)
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 152/479 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154873
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.