DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F3 and Cyp318a1

DIOPT Version :9

Sequence 1:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens
Sequence 2:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster


Alignment Length:561 Identity:130/561 - (23%)
Similarity:219/561 - (39%) Gaps:145/561 - (25%)


- Green bases have known domain annotations that are detailed below.


Human     8 SLGLWPMAASPWLLLLLVGASWLLARILAWTYTFYDNCCRL-------RCFPQPPKRNWFLGHLG 65
            ::.||...|             |||.:|||...   .|.||       |...|.|.. |.|..:.
  Fly     4 NIALWACGA-------------LLAVLLAWQQR---KCWRLIWQLNGWRGVIQQPVL-WLLLCIN 51

Human    66 LIHS-------SEEGLLYTQSLACTFGDMCCWWVGPWHAIVRIFHPTYIKPVLFAPAAIVPKDKV 123
            | |.       |:..:.:.:.||...|.         ..::.|..|..::.||.||..:   ||.
  Fly    52 L-HPNSILEKVSQYRVHFQRPLAVLVGT---------RVLLYIDDPAGMECVLNAPECL---DKT 103

Human   124 FYS---FLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQL----- 180
            |..   |::    .|||.:.|:||...|:.|.|||..||:..:..:||...|.|..::|.     
  Fly   104 FLQDGFFVR----RGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLH 164

Human   181 -LASEGSARLDMFE----HISLMTLDSLQKCVFSFDSHCQEKPSEYIA----AILELSAL-VTKR 235
             .|.:.:|..|:..    .:|.:|       :....::..:....:||    .:||:||: |.|.
  Fly   165 GQAVKFTAAEDLLSRAVLEVSCLT-------IMGTPTNFTQLDDAHIAHSYKRLLEISAVRVVKP 222

Human   236 HQQI-LLYIDFLYYLTPD-GQRFRRACRLVHDFTDAVIQERRRTL--------------PSQG-- 282
            ..|| ||:    ..|.|: .:..::..:|:.||...:::.:.|..              .|.|  
  Fly   223 WLQIRLLH----RLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQ 283

Human   283 ----VDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYH 343
                ::...|..|..                  :::.|:|..||.:.:....:|.::.:...|..
  Fly   284 RRIFIEQIFQLAANG------------------EMTLEEIMDEAQSMVLVSFETVSNSIMLALLC 330

Human   344 LAKHP-EYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIV 407
            ||.:. :.|.|...|::.|:.|  ..::..:.|.||.:|...:.|||||...||...|..::|..
  Fly   331 LATNKGDCQRRLLAEIRALVPD--VGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFR 393

Human   408 LPDGR----VIPKGIICLISVFGTHHNPAVW-PDPEVYDPFRFDPKNIKE--------------- 452
            |. ||    ::|:..|.::..|....:...| .:...:||.||..:..::               
  Fly   394 LA-GRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRR 457

Human   453 ----RSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRF 489
                |...:|:|||.|.|:|||:.:.:..|||.|...:..|
  Fly   458 QRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNF 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F3NP_000887.2 p450 52..515 CDD:365848 117/510 (23%)
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 116/507 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.