DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F3 and Cyp4ae1

DIOPT Version :9

Sequence 1:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens
Sequence 2:NP_525044.1 Gene:Cyp4ae1 / 31193 FlyBaseID:FBgn0015036 Length:496 Species:Drosophila melanogaster


Alignment Length:432 Identity:144/432 - (33%)
Similarity:247/432 - (57%) Gaps:26/432 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    96 HAIVRIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNIL 160
            |.::....|.:|..:|.....:  |....|..|:.|||||||||.|::|...|:::||.|||:||
  Fly    79 HVVMVTAEPRHIDALLQGQHQL--KKGTMYFALRGWLGDGLLLSRGKEWHTMRKIITPTFHFSIL 141

Human   161 KPYMKIFNESVNIMHAKWQLLASEGSARLDMFEHISLMTLDSLQKCVFSFDSHCQEKPSEYIAAI 225
            :.::::|:...:|:..:.:.| |.|:..::::..:.|..||.:.:.....:...|...||.:.|:
  Fly   142 EQFVEVFDRQSSILVERLRTL-SYGNEVVNIYPLVGLAALDIITETAMGVNVDAQGADSEVVHAV 205

Human   226 LELSALVTKRHQQILLYIDFLYYLT-PDGQRFRRA---CRLVHDFTDAVIQERRRTLPSQGVDDF 286
            .:|:.::..|..:..|....|:.|. |.|.|.::|   |  :|:||:.:|::|||.|..:...| 
  Fly   206 KDLTNILATRFMRPHLLFPHLFRLCWPSGFRKQQAGVIC--LHEFTNGIIEQRRRLLAREANQD- 267

Human   287 LQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQ 351
                ..:|....:|.||.: ..||:.|:|:.||.|.:||:|||||||.|.:|:.||.|::|...|
  Fly   268 ----KPTKPHALLDTLLRA-TVDGQPLTDKQIRDEVNTFIFEGHDTTTSAVSFCLYLLSRHEAVQ 327

Human   352 ERCRQEV-----QELLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDG 411
            ::..:|:     |:|.:.     :...|.|.||:|:..:||||||:||:|||:||..:|:|:.:|
  Fly   328 QKLFEELRMHYGQDLFRG-----VILSDFATLPYLSCVVKESLRLYPPIPAVARCLEKDLVIDEG 387

Human   412 RVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMA 476
             .||.|...::.::....:.|::.||.|:.|.|...:.....||.::|||||||||||||.||:.
  Fly   388 -YIPVGTNVVVLLWQLLRDEAIFTDPLVFQPERHLGEEAPRLSPYSYIPFSAGPRNCIGQKFALL 451

Human   477 EMKVVLGLTLLRFRVLPDHTEPRRKPELVLRAEGGLWLRVEP 518
            |||.::...:..:::||...:.....::|||::.|:.:.:.|
  Fly   452 EMKTMVTKVIRHYQLLPMGADVEPSIKIVLRSKSGVNVGLRP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F3NP_000887.2 p450 52..515 CDD:365848 143/427 (33%)
Cyp4ae1NP_525044.1 p450 35..486 CDD:278495 142/423 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154783
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.