DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F3 and Cyp4d1

DIOPT Version :9

Sequence 1:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens
Sequence 2:NP_476907.2 Gene:Cyp4d1 / 31188 FlyBaseID:FBgn0005670 Length:512 Species:Drosophila melanogaster


Alignment Length:441 Identity:156/441 - (35%)
Similarity:253/441 - (57%) Gaps:25/441 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    91 WVGPWHAIVRIFHPTYIKPVLFAPAAIVPKDKV-FYSFLKPWLGDGLLLSAGEKWSRHRRMLTPA 154
            |:|| ...|.:.:|..::.||   ..:...||. .|..|:|||.:|||:|.|.||.:.|:::|||
  Fly    77 WLGP-ELNVLMGNPKDVEVVL---GTLRFNDKAGEYKALEPWLKEGLLVSRGRKWHKRRKIITPA 137

Human   155 FHFNILKPYMKIFNE-SVNIMHAKWQLLASEGSARLDMFEHISLMTLDSLQKCVFSFDSHCQEK- 217
            |||.||..::::|.: |.:::....|.....|.:...:::.|:|.|:|::.:.......:.|.. 
  Fly   138 FHFKILDQFVEVFEKGSRDLLRNMEQDRLKHGDSGFSLYDWINLCTMDTICETAMGVSINAQSNA 202

Human   218 PSEYIAAILELSALVTKRHQQILLYIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQG 282
            .|||:.|:..:|.::.||...||...|..|.|||..:..::|..::|.||:.:|.:||..|..:|
  Fly   203 DSEYVQAVKTISMVLHKRMFNILYRFDLTYMLTPLARAEKKALNVLHQFTEKIIVQRREELIREG 267

Human   283 -----VDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLY 342
                 .:|.....||.| :.|:|:||.| ..|.:.||:.|||.|.|||||||||||:|.|.:..|
  Fly   268 SSQESSNDDADVGAKRK-MAFLDILLQS-TVDERPLSNLDIREEVDTFMFEGHDTTSSALMFFFY 330

Human   343 HLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIV 407
            ::|.|||.|::|.:|::.::.:.:...:.::.|.||.::.:|:||:||::|.||.:.|...:|..
  Fly   331 NIATHPEAQKKCFEEIRSVVGNDKSTPVSYELLNQLHYVDLCVKETLRMYPSVPLLGRKVLEDCE 395

Human   408 LPDGRVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPKNIKER-SPLAFIPFSAGPRNCIGQ 471
            : :|::||.|....||.........::.:|.::.|.|||.....|: :|.|:|||||||||||||
  Fly   396 I-NGKLIPAGTNIGISPLYLGRREELFSEPNIFKPERFDVVTTAEKLNPYAYIPFSAGPRNCIGQ 459

Human   472 AFAMAEMKVVLGLTLLRFRV--LPDHTEPRRKP----ELVLRAEGGLWLRV 516
            .|||.|:|.::...|..:.|  :.|.:||   |    ||:||.:..|..:|
  Fly   460 KFAMLEIKAIVANVLRHYEVDFVGDSSEP---PVLIAELILRTKEPLMFKV 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F3NP_000887.2 p450 52..515 CDD:365848 155/438 (35%)
Cyp4d1NP_476907.2 p450 35..507 CDD:278495 155/439 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154784
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.