DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F3 and Cyp4g1

DIOPT Version :9

Sequence 1:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens
Sequence 2:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster


Alignment Length:557 Identity:151/557 - (27%)
Similarity:265/557 - (47%) Gaps:70/557 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     5 SLSSLGLWPMAASPWLLLLLVGASWLLARILAW-----TYTFYDNCCRLRCFPQPPKRNWFLGHL 64
            |.:.||..||      |..|||....:|....|     .|....|      .|.||:    |..|
  Fly    18 STTVLGFSPM------LTTLVGTLVAMALYEYWRRNSREYRMVAN------IPSPPE----LPIL 66

Human    65 GLIHSSEEGLLYTQSLAC------TFGDMCCWWVGPWHAIVRIF--HPTYIKPVLFAPAAIVPKD 121
            |..|.: .||...:.||.      .:|:....|:|   .::.:|  :|:.|:.:|.....:...:
  Fly    67 GQAHVA-AGLSNAEILAVGLGYLNKYGETMKAWLG---NVLLVFLTNPSDIELILSGHQHLTKAE 127

Human   122 KVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGS 186
            :  |.:.|||.|||||:|.|..|..||:|:.|.||.:|||.::..|.:....:.|:..|   |..
  Fly   128 E--YRYFKPWFGDGLLISNGHHWRHHRKMIAPTFHQSILKSFVPTFVDHSKAVVARMGL---EAG 187

Human   187 ARLDMFEHISLMTLDSLQKCVFSFDSHCQ-EKPSEYIAAILELSALVTKRHQQILLYIDFLYYLT 250
            ...|:.:::|..|:|.|...........: .|..||..|::::..::.||..::|..:|.:|..|
  Fly   188 KSFDVHDYMSQTTVDILLSTAMGVKKLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFT 252

Human   251 PDGQRFRRACRLVHDFTDAVIQERRRTLPSQG-------------------------VDDFLQAK 290
            ...::..|...::...|..|:::|:.....:.                         :||..:..
  Fly   253 KLREKGDRMMNIILGMTSKVVKDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDEND 317

Human   291 AKSK-TLDFIDVLL-LSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQER 353
            ..:| .|..:|.:: ::|:.| .:.:::||..|.:|.||||||||::|.|:.|..:..|.:.|.:
  Fly   318 VGAKRRLALLDAMVEMAKNPD-IEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAK 381

Human   354 CRQEVQELLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDG-RVIPKG 417
            ...|.:.:..|...::..:.|..::.:|...|.|:|||:||||.::|....|:.|..| ..:|||
  Fly   382 VFAEQKAIFGDNMLRDCTFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKG 446

Human   418 IICLISVFGTHHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVL 482
            ...::..:..|..|.::|:|..:||..|.|:.:..|...:|||||||||:|:|:.:||.::||:|
  Fly   447 TTVIVLQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLL 511

Human   483 GLTLLRFRVLPDHTEP--RRKPELVLRAEGGLWLRVE 517
            ...:..:.|....||.  :.:.:::|:.|.|..:.:|
  Fly   512 STIVRNYIVHSTDTEADFKLQADIILKLENGFNVSLE 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F3NP_000887.2 p450 52..515 CDD:365848 137/501 (27%)
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 131/473 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.