DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and ARF1

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_010089.1 Gene:ARF1 / 851335 SGDID:S000002351 Length:181 Species:Saccharomyces cerevisiae


Alignment Length:180 Identity:142/180 - (78%)
Similarity:162/180 - (90%) Gaps:0/180 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV 65
            ||...:.||..|||.|||||||||||.|||||:||||||||::|||||||||||||:||||||||
Yeast     1 MGLFASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKNISFTV 65

  Fly    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDL 130
            |||||||:||.|||||::||:|:|||||||||.|||||||.:.|||.|||||:|..|:|||||||
Yeast    66 WDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFANKQDL 130

  Fly   131 PNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLKNA 180
            |.||:|||||:||||||:|||.|:|||||||||:||||||:||||.|||:
Yeast   131 PEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNSLKNS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 138/173 (80%)
ARF1NP_010089.1 P-loop_NTPase 5..179 CDD:422963 138/173 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 292 1.000 Domainoid score I232
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 300 1.000 Inparanoid score I502
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 1 1.000 - - mtm9165
orthoMCL 1 0.900 - - OOG6_100600
Panther 1 1.100 - - LDO PTHR11711
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2403
SonicParanoid 1 1.000 - - X414
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.