DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and ARFD1A

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_563652.1 Gene:ARFD1A / 839230 AraportID:AT1G02440 Length:190 Species:Arabidopsis thaliana


Alignment Length:194 Identity:88/194 - (45%)
Similarity:131/194 - (67%) Gaps:17/194 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGE-IVTTIPTIGFNVETVEYKNISFT 64
            ||......|.|.|.::|.||::.||...||::|::|.|.|| :.||:||:|.|||:|:||:.:..
plant     1 MGTTLGKPFAGFFHQEEARIVLFGLGGTGKSSIMHKFKTGETLTTTMPTVGLNVESVKYKDSNLC 65

  Fly    65 VWDVGGQDKIR--PLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAV-----LL 122
            .|::|||....  |||:|:||...||:.||||..|::|.|.::.|..::  ||::.:|     :|
plant    66 FWEMGGQQCYMWFPLWKHWFQEIAGLVLVVDSTGRDQIEETKDFLNVVI--DEIQGSVPDNAPVL 128

  Fly   123 IFANKQDLPNAMNAAEITDKLGLHSLR----NRNWYIQATCATSGDGLYEGLDWLSNQLKNANR 182
            ::.||.::|.||:|:||::||.|.|||    .|||::|::||.|||||:||||||   ||||.|
plant   129 VYGNKHEVPGAMSASEISNKLDLTSLRKKNWQRNWHVQSSCAFSGDGLHEGLDWL---LKNAER 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 82/185 (44%)
ARFD1ANP_563652.1 Gem1 15..>145 CDD:224025 53/131 (40%)
Arf_Arl 19..186 CDD:206644 78/171 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11711
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.