DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and ARFA1B

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001318560.1 Gene:ARFA1B / 831319 AraportID:AT5G14670 Length:188 Species:Arabidopsis thaliana


Alignment Length:177 Identity:157/177 - (88%)
Similarity:165/177 - (93%) Gaps:0/177 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV 65
            ||..|..||..||.|||||||||||||||||||||||||||||||||||||||||||||||||||
plant     1 MGLNFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV 65

  Fly    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDL 130
            ||||||||||||||||||||||||||||||||:|:.|||:||.|||.||||||||||:|||||||
plant    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDL 130

  Fly   131 PNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQL 177
            |||||||||||||||||||.|:||||:||||||:|||||||||||.:
plant   131 PNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 155/173 (90%)
ARFA1BNP_001318560.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 316 1.000 Domainoid score I295
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 322 1.000 Inparanoid score I698
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 1 1.000 - - otm2916
orthoMCL 1 0.900 - - OOG6_100600
Panther 1 1.100 - - LDO PTHR11711
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X414
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.930

Return to query results.
Submit another query.