DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf1 and ARF3

DIOPT Version :10

Sequence 1:NP_476955.1 Gene:Arf1 / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_850057.1 Gene:ARF3 / 817014 AraportID:AT2G24765 Length:182 Species:Arabidopsis thaliana


Alignment Length:68 Identity:14/68 - (20%)
Similarity:27/68 - (39%) Gaps:15/68 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   461 KFIILCLITRLSVTLQRNENMDLQEVEF--------IESSEIFKLIPC----ILHF---VLPMKL 510
            :::.:|...|.:|.:.|...:.|....:        |.::..|.|..|    |.||   :.|:..
plant   113 RYVAICNPLRYTVIMNRRLCLQLAATSWMIGFTYSTIHTANTFTLKFCRSNVIDHFFCDIPPLLK 177

  Fly   511 MVC 513
            :.|
plant   178 ISC 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf1NP_476955.1 ARF 5..179 CDD:128474
ARF3NP_850057.1 Arl1 19..176 CDD:206718 13/62 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.