DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and ARFB1A

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_179133.1 Gene:ARFB1A / 816020 AraportID:AT2G15310 Length:205 Species:Arabidopsis thaliana


Alignment Length:179 Identity:119/179 - (66%)
Similarity:142/179 - (79%) Gaps:0/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV 65
            ||..|:.:.|....|.::||||||||.:|||||||||||||:|||:||||||:||||||.|:|||
plant     1 MGARFSRIAKRFLPKSKVRILMVGLDGSGKTTILYKLKLGEVVTTVPTIGFNLETVEYKGINFTV 65

  Fly    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDL 130
            ||:|||:|||.||||||||.|||||||||:|.||:.|||.||.|:|.::||..|.:|:||||||.
plant    66 WDIGGQEKIRKLWRHYFQNAQGLIFVVDSSDSERLSEARNELHRILTDNELEGACVLVFANKQDS 130

  Fly   131 PNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLKN 179
            .||:..||:.:|||||||..|.|.||.|.|.||.||||||:|||..:.|
plant   131 RNALPVAEVANKLGLHSLSKRCWLIQGTSAISGQGLYEGLEWLSTTIPN 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 116/173 (67%)
ARFB1ANP_179133.1 P-loop_NTPase 1..180 CDD:304359 119/179 (66%)
Ras 19..179 CDD:278499 113/159 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11711
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.