DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and Arf4

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_077065.1 Gene:Arf4 / 79120 RGDID:621275 Length:180 Species:Rattus norvegicus


Alignment Length:177 Identity:148/177 - (83%)
Similarity:158/177 - (89%) Gaps:0/177 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV 65
            ||...::||..|||||:||||||||||||||||||||||||||||||||||||||||||||.|||
  Rat     1 MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTV 65

  Fly    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDL 130
            |||||||||||||||||||||||||||||||||||.|....|.:||.||||:|||||:|||||||
  Rat    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEGAAVLQKMLLEDELQDAVLLLFANKQDL 130

  Fly   131 PNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQL 177
            ||||..:|:||||||.|||||.||:||||||.|.|||||||||||:|
  Rat   131 PNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNEL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 146/173 (84%)
Arf4NP_077065.1 YlqF_related_GTPase 1..180 CDD:424112 148/177 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.