DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and Arl14

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_082119.1 Gene:Arl14 / 71619 MGIID:1918869 Length:192 Species:Mus musculus


Alignment Length:170 Identity:79/170 - (46%)
Similarity:122/170 - (71%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYK-NISFTVWDVGGQDKIRPLWR 79
            |:..||::|||:|||:|:||:||..|.::||||||||||.|:.: :::.||||||||:|:|.:|.
Mouse    12 KQAHILLLGLDSAGKSTLLYRLKFAETLSTIPTIGFNVEMVQLQSSLTLTVWDVGGQEKMRTVWD 76

  Fly    80 HYFQNTQGLIFVVD-SNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKL 143
            .|.:|.|||::||| |..::|:.::|:|...:|..:.:::..::|.|||||||.|::|.:||...
Mouse    77 CYCENAQGLMYVVDCSEGKKRLEDSRKEFKHILKNEHIKNTPVVILANKQDLPGALSAEDITRMF 141

  Fly   144 GLHSL-RNRNWYIQATCATSGDGLYEGLDWLSNQLKNANR 182
            .:..| .|||||:|..||.:|:||.:|...|:..||:..|
Mouse   142 KVKKLCSNRNWYVQPCCAVTGEGLDDGFRKLTEFLKSYRR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 77/165 (47%)
Arl14NP_082119.1 SAR 1..176 CDD:197556 76/163 (47%)
ARLTS1 15..175 CDD:133356 75/159 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.