DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and Arf1

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_008766092.1 Gene:Arf1 / 64310 RGDID:621270 Length:195 Species:Rattus norvegicus


Alignment Length:179 Identity:173/179 - (96%)
Similarity:178/179 - (99%) Gaps:0/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV 65
            |||:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat    15 MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV 79

  Fly    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDL 130
            ||||||||||||||||||||||||||||||||||:.|||||||||||||||||||||:|||||||
  Rat    80 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDL 144

  Fly   131 PNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLKN 179
            |||||||||||||||||||:|||||||||||||||||||||||||||:|
  Rat   145 PNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRN 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 169/173 (98%)
Arf1XP_008766092.1 ARF 19..193 CDD:128474 169/173 (98%)
Gem1 27..>153 CDD:224025 122/125 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337609
Domainoid 1 1.000 340 1.000 Domainoid score I1056
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133930
Inparanoid 1 1.050 357 1.000 Inparanoid score I2160
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 1 1.000 - - otm44530
orthoMCL 1 0.900 - - OOG6_100600
Panther 1 1.100 - - LDO PTHR11711
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X414
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.