DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf1 and SAR1A

DIOPT Version :10

Sequence 1:NP_476955.1 Gene:Arf1 / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_064535.1 Gene:SAR1A / 56681 HGNCID:10534 Length:198 Species:Homo sapiens


Alignment Length:189 Identity:54/189 - (28%)
Similarity:99/189 - (52%) Gaps:15/189 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NVFANL--FKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV 65
            |.|:::  |.||: ||..:::.:|||.|||||:|:.||...:...:||:....|.:....::||.
Human    10 NGFSSVLQFLGLY-KKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTT 73

  Fly    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDL 130
            :|:||.::.|.:|::|.....|::|:||..|..|:.|::.||..::.::.:.:..:||..||.|.
Human    74 FDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGNKIDR 138

  Fly   131 PNAMNAAEITDKLGLH------------SLRNRNWYIQATCATSGDGLYEGLDWLSNQL 177
            .:|::..::.:..||:            .|..|...:.........|..||..|||..:
Human   139 TDAISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYI 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf1NP_476955.1 ARF 5..179 CDD:128474 53/187 (28%)
SAR1ANP_064535.1 Sar1 3..197 CDD:206645 54/187 (29%)
STAR, SAR1-N-terminal activation recruitment. Required for the activation by PREB and subsequent recruitment to ER membrane. /evidence=ECO:0000250|UniProtKB:Q9QVY3 3..5
Mediates recruitment to ER membranes. /evidence=ECO:0000250|UniProtKB:Q9QVY3 15..19 0/3 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.