DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and arl10

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001373165.1 Gene:arl10 / 560654 ZFINID:ZDB-GENE-091204-51 Length:270 Species:Danio rerio


Alignment Length:153 Identity:49/153 - (32%)
Similarity:85/153 - (55%) Gaps:3/153 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KKEMRILMVGLDAAGKTTILYKLK-LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLW 78
            :.|.::|::|||.|||:::|..|. .|......||.|||..::..........::||.:.:|..|
Zfish   103 RSEKQVLVLGLDGAGKSSVLQGLSGAGYRRGCRPTRGFNFISLNTPACQLDFLEIGGGEDLRMYW 167

  Fly    79 RHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKL 143
            ..|.:.|..|::||||:||.|:.:|::||.|:|..:  .|..:::..||||.|:|::..|:.:.|
Zfish   168 ADYLRRTNILVYVVDSSDRSRLPQAKDELHRLLKAE--TDLPVVVLGNKQDKPDAVSVPELREAL 230

  Fly   144 GLHSLRNRNWYIQATCATSGDGL 166
            .|.|:.::.........:..|||
Zfish   231 SLSSVADQRKLFLLAAQSGSDGL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 49/153 (32%)
arl10NP_001373165.1 P-loop_NTPase 107..270 CDD:422963 48/149 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.