DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and arf4b

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001017707.1 Gene:arf4b / 550402 ZFINID:ZDB-GENE-050417-205 Length:180 Species:Danio rerio


Alignment Length:177 Identity:134/177 - (75%)
Similarity:156/177 - (88%) Gaps:0/177 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV 65
            ||..|:||:..||.|||||:||||||||||||:||||||||:||||||:|||||||||:||||||
Zfish     1 MGVFFSNLWTRLFEKKEMRLLMVGLDAAGKTTVLYKLKLGEVVTTIPTLGFNVETVEYRNISFTV 65

  Fly    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDL 130
            |||||||.||.|||||:|||:||||||||:||:||..|.|||..||||||:||||||:.||||||
Zfish    66 WDVGGQDIIRRLWRHYYQNTKGLIFVVDSSDRDRIETAAEELKMMLAEDEMRDAVLLVLANKQDL 130

  Fly   131 PNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQL 177
            |.||.|.|:|::||||:||.|.|::|:|||..|.|||||||||::||
Zfish   131 PKAMAAHELTERLGLHALRGRQWFVQSTCAVQGSGLYEGLDWLTDQL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 132/173 (76%)
arf4bNP_001017707.1 P-loop_NTPase 1..180 CDD:304359 134/177 (76%)
SAR 15..174 CDD:197556 124/158 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.