DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and arl14

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001015791.1 Gene:arl14 / 548508 XenbaseID:XB-GENE-5750500 Length:201 Species:Xenopus tropicalis


Alignment Length:176 Identity:84/176 - (47%)
Similarity:119/176 - (67%) Gaps:7/176 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GLFGK-----KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE-YKNISFTVWDVG 69
            ||.|.     |:.|||::|||.|||:|:|||.|..|...||||:|||||.:. .|::..|:||||
 Frog     2 GLSGSSHSKVKQARILILGLDDAGKSTVLYKFKFKEPFITIPTVGFNVEMIHTEKHLQLTMWDVG 66

  Fly    70 GQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAM 134
            ||.|:|..|.|||:||.||::||||||.:.:.|:::|...:|..:.::|..:::.|||||||.|:
 Frog    67 GQQKLRSFWCHYFENTDGLVYVVDSNDSKHLDESKKEFQHVLQNELIKDVPVVLLANKQDLPGAL 131

  Fly   135 NAAEITDKLGLHS-LRNRNWYIQATCATSGDGLYEGLDWLSNQLKN 179
            ||.|||.|..:.. ..:|:||:|..||.:|.||.|||..::..:||
 Frog   132 NAEEITRKFNMKKYCSDRDWYVQPCCAHTGQGLAEGLSKVTEFVKN 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 82/174 (47%)
arl14NP_001015791.1 ARLTS1 15..174 CDD:133356 78/158 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.