DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and Arl4

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster


Alignment Length:274 Identity:87/274 - (31%)
Similarity:115/274 - (41%) Gaps:114/274 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE-----YKNISFTVWDVGGQDKIRPL 77
            :.::|:|||:|||||.||:||..:.:.|:||||||.|.|:     .|.:.|.|||||||:|:|||
  Fly    26 LHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPL 90

  Fly    78 WRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDK 142
            ||.|.:.|.|::||:||.|.||:.||:.||||.....:.:...:||.|||||||||..|.|:...
  Fly    91 WRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLPNACGAMELEKL 155

  Fly   143 LGLHSLRN--------------------------------------------------------- 150
            |||:.|.|                                                         
  Fly   156 LGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHSSMIHIKPALESKD 220

  Fly   151 ----------------------------------------------------RNWYIQATCATSG 163
                                                                |.||||.|||.:|
  Fly   221 HNSTLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQFRGWYIQPTCAITG 285

  Fly   164 DGLYEGLDWLSNQL 177
            :||.||||.|.:.:
  Fly   286 EGLQEGLDALYDMI 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 87/274 (32%)
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 87/274 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455860
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.