DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and arf1

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001001905.1 Gene:arf1 / 431681 XenbaseID:XB-GENE-950251 Length:181 Species:Xenopus tropicalis


Alignment Length:179 Identity:173/179 - (96%)
Similarity:177/179 - (98%) Gaps:0/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV 65
            |||:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog     1 MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV 65

  Fly    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDL 130
            ||||||||||||||||||||||||||||||||||:.||||||.||||||||||||||:|||||||
 Frog    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDL 130

  Fly   131 PNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLKN 179
            |||||||||||||||||||:|||||||||||||||||||||||||||||
 Frog   131 PNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLKN 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 168/173 (97%)
arf1NP_001001905.1 ARF 5..179 CDD:128474 168/173 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 341 1.000 Domainoid score I1081
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 357 1.000 Inparanoid score I2177
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 1 1.000 - - otm47570
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2403
SonicParanoid 1 1.000 - - X414
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.