DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and Arl2

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster


Alignment Length:175 Identity:78/175 - (44%)
Similarity:113/175 - (64%) Gaps:5/175 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNVFANLFKGLFGK-KEMRILMVGLDAAGKTTILYKLKLGEIVTTI-PTIGFNVETVEYKNISF 63
            ||  |..:.|.:..| :|||||::|||.|||||||.:.. ||.:.|| ||:|||::|:|:...:.
  Fly     1 MG--FLTVLKKMRQKEREMRILLLGLDNAGKTTILKRFN-GEPIDTISPTLGFNIKTLEHNGYTL 62

  Fly    64 TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQ 128
            .:||||||..:|..||:||::|.||::||||.||.|:....:||..:|.|:.|..|.||:..|||
  Fly    63 NMWDVGGQKSLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQ 127

  Fly   129 DLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWL 173
            |||.|:::.||.:.|.|..:...:|.:....|.:|:.|...:|||
  Fly   128 DLPGALSSNEIKEILHLEDITTHHWLVAGVSAVTGEKLLSSMDWL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 76/171 (44%)
Arl2NP_476886.1 Arl2 3..175 CDD:206720 76/171 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455868
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.