DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf1 and Arl2

DIOPT Version :10

Sequence 1:NP_476955.1 Gene:Arf1 / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster


Alignment Length:175 Identity:78/175 - (44%)
Similarity:113/175 - (64%) Gaps:5/175 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNVFANLFKGLFGK-KEMRILMVGLDAAGKTTILYKLKLGEIVTTI-PTIGFNVETVEYKNISF 63
            ||  |..:.|.:..| :|||||::|||.|||||||.:.. ||.:.|| ||:|||::|:|:...:.
  Fly     1 MG--FLTVLKKMRQKEREMRILLLGLDNAGKTTILKRFN-GEPIDTISPTLGFNIKTLEHNGYTL 62

  Fly    64 TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQ 128
            .:||||||..:|..||:||::|.||::||||.||.|:....:||..:|.|:.|..|.||:..|||
  Fly    63 NMWDVGGQKSLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQ 127

  Fly   129 DLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWL 173
            |||.|:::.||.:.|.|..:...:|.:....|.:|:.|...:|||
  Fly   128 DLPGALSSNEIKEILHLEDITTHHWLVAGVSAVTGEKLLSSMDWL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf1NP_476955.1 ARF 5..179 CDD:128474 76/171 (44%)
Arl2NP_476886.1 Arl2 3..175 CDD:206720 76/171 (44%)

Return to query results.
Submit another query.