DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and arl10

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_989044.1 Gene:arl10 / 394641 XenbaseID:XB-GENE-945631 Length:237 Species:Xenopus tropicalis


Alignment Length:151 Identity:54/151 - (35%)
Similarity:85/151 - (56%) Gaps:5/151 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EMRILMVGLDAAGKTTILYKLKLGEI-VTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH 80
            :.:||::|||.|||::|::.:..... .::.||.|||...:.::.:...:.:|||...:|..|..
 Frog    45 DRQILVLGLDGAGKSSIIHAISTNTTRSSSAPTHGFNSAQIIHQGLRIELLEVGGSQNLRTYWSQ 109

  Fly    81 YFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGL 145
            |.:|...::|||||.|.:|:..||:||.|:|  .|..|..|::.|||||...|:...||..:|.|
 Frog   110 YLKNANVIVFVVDSTDNKRLHLARQELHRLL--HEAPDLPLMVLANKQDQNTALCLPEIHSELSL 172

  Fly   146 HSLR-NRNWYIQATCATSGDG 165
            |.:. .|...:..|.|.| ||
 Frog   173 HRITGEREVTLLGTSAVS-DG 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 54/151 (36%)
arl10NP_989044.1 P-loop_NTPase 47..210 CDD:328724 54/149 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.