DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and arl4aa

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_957154.1 Gene:arl4aa / 393834 ZFINID:ZDB-GENE-040426-1878 Length:200 Species:Danio rerio


Alignment Length:186 Identity:80/186 - (43%)
Similarity:116/186 - (62%) Gaps:9/186 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNVFA---NLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETV-----E 57
            |||..:   |....|.....:.|.::|||:|||||:||:|:..|.|.|:||.|||.|.|     :
Zfish     1 MGNGISDQPNFLSSLPFCNSLHIAILGLDSAGKTTVLYRLQFNEFVNTVPTRGFNAEKVRIPVGD 65

  Fly    58 YKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLL 122
            .:.::|..||||||:|:||||:.|.:.|.|::|||||.|.||:.||:.||.::....|.:...:|
Zfish    66 SRTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSLDAERMEEAKTELYKIARSTENQGVPVL 130

  Fly   123 IFANKQDLPNAMNAAEITDKLGLHSL-RNRNWYIQATCATSGDGLYEGLDWLSNQL 177
            |.|||||:..|:..::|...|.|:.| .:..|::|.|||..||||.|||:.|.:.:
Zfish   131 IIANKQDMRQALPLSQIETMLALNELGPSTPWHLQPTCAIIGDGLKEGLERLHDMI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 77/182 (42%)
arl4aaNP_957154.1 Gem1 17..>162 CDD:224025 62/144 (43%)
Arl4_Arl7 20..193 CDD:206719 75/167 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.