DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and TRIM23

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001647.1 Gene:TRIM23 / 373 HGNCID:660 Length:574 Species:Homo sapiens


Alignment Length:164 Identity:105/164 - (64%)
Similarity:129/164 - (78%) Gaps:1/164 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWR 79
            |.|:|::.:|||.|||||||:|||..|.:..|||||||||||||||:.||:|||||:.|:||||:
Human   402 KMEIRVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWK 466

  Fly    80 HYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLG 144
            ||:.|||.::|||||:.|:||.||..||.::|.|.|||||:|||||||||:..|::..|||:.|.
Human   467 HYYLNTQAVVFVVDSSHRDRISEAHSELAKLLTEKELRDALLLIFANKQDVAGALSVEEITELLS 531

  Fly   145 LHSL-RNRNWYIQATCATSGDGLYEGLDWLSNQL 177
            ||.| ..|:||||...|.||.||||||||||.||
Human   532 LHKLCCGRSWYIQGCDARSGMGLYEGLDWLSRQL 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 105/164 (64%)
TRIM23NP_001647.1 mRING-HC-C3HC3D_TRIM23_C-IX 28..77 CDD:319559
Bbox2_TRIM23_C-IX_rpt1 123..172 CDD:380831
Bbox2_TRIM23_C-IX_rpt2 174..223 CDD:380832
BBC 226..370 CDD:128778
ARF-like 390..574 105/164 (64%)
ARD1 406..574 CDD:206723 103/160 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.