DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf1 and CG13692

DIOPT Version :10

Sequence 1:NP_476955.1 Gene:Arf1 / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_608523.1 Gene:CG13692 / 33216 FlyBaseID:FBgn0031254 Length:193 Species:Drosophila melanogaster


Alignment Length:192 Identity:49/192 - (25%)
Similarity:82/192 - (42%) Gaps:45/192 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LMVGLDAAGKTTILYKLK----LGEIVTTIPTIGFNVETVEY----------------------- 58
            :.:|...||||.:|..|:    :.|...::||||..:..:.:                       
  Fly     5 ICLGPKRAGKTHLLKALQDPESIDETTFSMPTIGTGIYRIHFPTKSPNGDKNKPPPSEAPANIPH 69

  Fly    59 --KNI--SFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELR-- 117
              ||:  |..:.::||  .:.||||.||::.:.||:|||:::..:|..|......:|.|..|:  
  Fly    70 GGKNLPKSIQILEIGG--SMAPLWRQYFEDVKKLIYVVDTSNLCQISAAGVLFYSILTEPRLQHN 132

  Fly   118 DAVLLIFANKQDLPNAMNAAEITDKLGLHSL----RNRNWYIQATCATSG--DGLYEGLDWL 173
            ..:||:.| |.|........|....|.:..|    |.:...::|:..|..  |.:|   |||
  Fly   133 TKILLVLA-KMDYSYRQMRNEALLMLQMQKLQKQIRQQVTIVEASAVTKVGLDPIY---DWL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf1NP_476955.1 ARF 5..179 CDD:128474 49/192 (26%)
CG13692NP_608523.1 P-loop containing Nucleoside Triphosphate Hydrolases 4..191 CDD:476819 49/192 (26%)

Return to query results.
Submit another query.