DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and arl4d

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_955938.1 Gene:arl4d / 323573 ZFINID:ZDB-GENE-030131-2293 Length:200 Species:Danio rerio


Alignment Length:168 Identity:69/168 - (41%)
Similarity:109/168 - (64%) Gaps:6/168 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-----KNISFTVWDVGGQDKIR 75
            :.:.::::|||::|||::||:|||.|.|.||||.|||.|.::.     :.|:|..||||||:|:|
Zfish    19 QSLHVVVIGLDSSGKTSLLYRLKLKEFVETIPTKGFNTEKIKVPVGNGRAITFQAWDVGGQEKLR 83

  Fly    76 PLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEIT 140
            |||:.|.:.|.|::|||||.:.||:.||:.||.::....|.:...:|:.|||||||.|:..:::.
Zfish    84 PLWKSYTRRTDGMVFVVDSTEVERMEEAKVELHKITRTSENQGVPVLVLANKQDLPVALPVSDVE 148

  Fly   141 DKLGLHSL-RNRNWYIQATCATSGDGLYEGLDWLSNQL 177
            ..|.:|.| .:...::|...|..|.||..||:.|.:.:
Zfish   149 KVLAVHELSASTLHHVQGCSAVDGQGLQLGLEKLYDMI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 69/168 (41%)
arl4dNP_955938.1 Arl4_Arl7 18..200 CDD:206719 69/168 (41%)
small_GTP 23..188 CDD:272973 69/164 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.