DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and arf1

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_596118.1 Gene:arf1 / 2540899 PomBaseID:SPBC4F6.18c Length:180 Species:Schizosaccharomyces pombe


Alignment Length:179 Identity:158/179 - (88%)
Similarity:167/179 - (93%) Gaps:0/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV 65
            ||...:.||:.||||:||||||||||||||||||||||||||||||||||||||||||:||||||
pombe     1 MGLSISKLFQSLFGKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYRNISFTV 65

  Fly    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDL 130
            ||||||||||||||||||||||:||||||||||||.||.|||.|||.|||||||:||:|||||||
pombe    66 WDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRERISEAHEELQRMLNEDELRDALLLVFANKQDL 130

  Fly   131 PNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLKN 179
            |||||||||||||||||||:|.||||||||||||||||||:|||..|||
pombe   131 PNAMNAAEITDKLGLHSLRHRQWYIQATCATSGDGLYEGLEWLSTNLKN 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 154/173 (89%)
arf1NP_596118.1 P-loop_NTPase 1..180 CDD:304359 158/179 (88%)
SAR 15..174 CDD:197556 146/158 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 316 1.000 Domainoid score I238
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 325 1.000 Inparanoid score I540
OMA 1 1.010 - - QHG53833
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 1 1.000 - - oto100524
orthoMCL 1 0.900 - - OOG6_100600
Panther 1 1.100 - - LDO PTHR11711
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2403
SonicParanoid 1 1.000 - - X414
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.