DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and Arl11

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_796311.2 Gene:Arl11 / 219144 MGIID:2444054 Length:176 Species:Mus musculus


Alignment Length:166 Identity:71/166 - (42%)
Similarity:107/166 - (64%) Gaps:1/166 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYK-NISFTVWDVGGQDKIRPLW 78
            |.|.:::|:|||:|||||||||||..::|.|:||:|||||.:|.. ::|.|:||:|||.::|..|
Mouse    10 KAEAQVVMMGLDSAGKTTILYKLKGNQLVDTLPTVGFNVEPLEAPGHVSLTLWDIGGQTQLRATW 74

  Fly    79 RHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKL 143
            :.|.:....|::|:||.|..|:.||..||..:|.:..:.....|:.||||:.|.|:...||.::|
Mouse    75 KDYLEGIDLLVYVLDSTDEARLPEAVAELKEVLEDPNMAGVPFLVLANKQEAPGALPLLEIRNRL 139

  Fly   144 GLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLKN 179
            ||...:...|.::|..|.:|.||.|.|..|.:.||:
Mouse   140 GLEGFQKHCWELRACSALTGQGLQEALQSLLHLLKS 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 70/164 (43%)
Arl11NP_796311.2 P-loop_NTPase 14..169 CDD:393306 66/154 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.