DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and arf-6

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_503011.1 Gene:arf-6 / 191608 WormBaseID:WBGene00000184 Length:175 Species:Caenorhabditis elegans


Alignment Length:167 Identity:115/167 - (68%)
Similarity:142/167 - (85%) Gaps:0/167 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRP 76
            :|||||:||||:|||||||||||||||||:.||||||:|||||||.||||.|.||||||||||||
 Worm     8 IFGKKELRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNIKFNVWDVGGQDKIRP 72

  Fly    77 LWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITD 141
            |||||:..||.||||:|:.||:|:.|||.||.|::.:.|:::|::|:|||||||.:||...||.|
 Worm    73 LWRHYYTGTQALIFVMDAADRDRVDEARMELHRIINDREMKEAIILVFANKQDLADAMKPHEIQD 137

  Fly   142 KLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLK 178
            ||||..:|:||||:|.:||::||||:|||.|||...|
 Worm   138 KLGLTRIRDRNWYVQPSCASTGDGLHEGLTWLSQNCK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 115/167 (69%)
arf-6NP_503011.1 Arf6 5..172 CDD:206716 114/163 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.