DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and arf-1

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001367325.1 Gene:arf-1 / 175801 WormBaseID:WBGene00000182 Length:181 Species:Caenorhabditis elegans


Alignment Length:179 Identity:171/179 - (95%)
Similarity:177/179 - (98%) Gaps:0/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV 65
            |||||.:||||||||:|||||||||||||||||||||||||||||||||||||||||||||||||
 Worm     1 MGNVFGSLFKGLFGKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV 65

  Fly    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDL 130
            ||||||||||||||||||||||||||||||||||:||||||||||||||||||||||:|||||||
 Worm    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDL 130

  Fly   131 PNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLKN 179
            |.||||||:||||||||||||:|||||||||||||||||||||||||||
 Worm   131 PQAMNAAEVTDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSNQLKN 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 165/173 (95%)
arf-1NP_001367325.1 P-loop_NTPase 5..179 CDD:422963 165/173 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157881
Domainoid 1 1.000 337 1.000 Domainoid score I592
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133930
Inparanoid 1 1.050 353 1.000 Inparanoid score I1323
Isobase 1 0.950 - 0 Normalized mean entropy S16
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 1 1.000 - - oto18675
orthoMCL 1 0.900 - - OOG6_100600
Panther 1 1.100 - - O PTHR11711
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2403
SonicParanoid 1 1.000 - - X414
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1615.790

Return to query results.
Submit another query.