DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and arc-1

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_496089.3 Gene:arc-1 / 174525 WormBaseID:WBGene00000180 Length:539 Species:Caenorhabditis elegans


Alignment Length:173 Identity:60/173 - (34%)
Similarity:97/173 - (56%) Gaps:15/173 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EMRILMVGLDAAGKTTILYKLKLGEIVTTI---PTIGFNVETVEYKNISFTVWDVGGQDKIRPLW 78
            |.|::::|||.||||:|:.:||..::.|.:   ||||||:||:.|||.....|||||..|:|.||
 Worm   369 ESRVVLLGLDGAGKTSIVRRLKKVQMDTVMAPHPTIGFNIETIHYKNYRLNFWDVGGLPKLRHLW 433

  Fly    79 RHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQD---LPNAMNAAEIT 140
            :||:.|.|.:.:|:|....||..||.:||.|::::..:....:::..|::|   |...|:|.   
 Worm   434 KHYYSNAQAIFYVIDGYAVERFSEAIKELNRVMSDPLVGTCPVIVAVNRKDGYALNGHMDAL--- 495

  Fly   141 DKLGLHSLRNRNWYIQATC--ATSGDGLYEGLDWLSNQLKNAN 181
                |..|....:.....|  |.:|.|:.:.:|.::..|...|
 Worm   496 ----LSQLEALPFQHHFHCCDAATGSGIDQIIDQITVCLSRLN 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 59/169 (35%)
arc-1NP_496089.3 zf-RING_5 6..54 CDD:291308
zf-B_box 105..149 CDD:279037
Apolipoprotein 201..>306 CDD:279749
BBC 208..339 CDD:128778
Arf_Arl 371..526 CDD:206644 57/161 (35%)
small_GTP 371..526 CDD:272973 57/161 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11711
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.