DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and Arl1

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_080135.2 Gene:Arl1 / 104303 MGIID:99436 Length:181 Species:Mus musculus


Alignment Length:179 Identity:105/179 - (58%)
Similarity:138/179 - (77%) Gaps:0/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV 65
            ||..|:::|..|||.:|||||::|||.||||||||:|::||:||||||||||||||.|||:.|.|
Mouse     1 MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQV 65

  Fly    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDL 130
            ||:|||..|||.||.|:.||..:|:||||.||:|||.::.||:.||.|:|||.|:|::||||||:
Mouse    66 WDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDM 130

  Fly   131 PNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLKN 179
            ..||..:|:.:.|||.:|::|.|.|..|.||.|.||.|.::||...||:
Mouse   131 EQAMTPSEMANALGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKS 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 102/173 (59%)
Arl1NP_080135.2 Arl1 19..176 CDD:206718 94/156 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.