DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and arf11l.2

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_004918747.2 Gene:arf11l.2 / 101734701 XenbaseID:XB-GENE-22065200 Length:188 Species:Xenopus tropicalis


Alignment Length:182 Identity:103/182 - (56%)
Similarity:132/182 - (72%) Gaps:5/182 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNVFANLFK---GLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE-YKNI 61
            |||:|::|::   |..|.| .||:|:|||||||||:|||||..|.||||||||||||||| ..|:
 Frog     1 MGNLFSSLYQILMGFHGTK-ARIIMLGLDAAGKTTVLYKLKFNETVTTIPTIGFNVETVEPMHNV 64

  Fly    62 SFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFAN 126
            ||||||||||.:||.||::||.|..||:|||||.|.||..|||.||..:|..||:|....::.||
 Frog    65 SFTVWDVGGQGRIRALWKYYFTNADGLVFVVDSADCERFQEARLELEAILDTDEMRGVPFVVMAN 129

  Fly   127 KQDLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLK 178
            |||||.:....|:.::|||..::...|::|..|||:||||.|||:..:|.:|
 Frog   130 KQDLPGSRRPMEVAEELGLPKIQGHPWHVQGCCATTGDGLVEGLEVFTNLVK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 100/178 (56%)
arf11l.2XP_004918747.2 Arf_Arl 21..174 CDD:206644 92/152 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.