DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and ARL4C

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001269360.1 Gene:ARL4C / 10123 HGNCID:698 Length:201 Species:Homo sapiens


Alignment Length:181 Identity:85/181 - (46%)
Similarity:118/181 - (65%) Gaps:14/181 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNVFANL--FKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN--- 60
            |||:.:|:  |:.|      .|:|:|||:|||||:||:||..|.|.|:||||||.|.::..|   
Human     1 MGNISSNISAFQSL------HIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTA 59

  Fly    61 --ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLI 123
              ||...||||||:|:||||:.|.:.|.|:|:||||.|.:|:.||:.||.::....|.:...||:
Human    60 KGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLV 124

  Fly   124 FANKQDLPNAMNAAEITDKLGLHSL-RNRNWYIQATCATSGDGLYEGLDWL 173
            .|||||||.::..|||..:|.||.| ....:::|..||..|:||.||:|.|
Human   125 IANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 82/177 (46%)
ARL4CNP_001269360.1 Arl4_Arl7 11..192 CDD:206719 81/171 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.