DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and arl11

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_002935781.1 Gene:arl11 / 100490310 XenbaseID:XB-GENE-1012125 Length:180 Species:Xenopus tropicalis


Alignment Length:165 Identity:80/165 - (48%)
Similarity:118/165 - (71%) Gaps:1/165 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLW 78
            ||:.|::|:|||.:||:|||||||:.::|.|.||:|||||.:|. ||:|.||||||||||:||.|
 Frog    11 KKQPRVVMMGLDYSGKSTILYKLKINQLVETFPTVGFNVEHIEMSKNVSVTVWDVGGQDKLRPNW 75

  Fly    79 RHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKL 143
            :.|.::|..|||||||:|.:|:.:|..||:.:|..:.:.....||.|||||:.:|:.|.|:...|
 Frog    76 KEYLEDTDVLIFVVDSSDPDRLPDATAELLSILNNENMAGVPFLILANKQDITDALPAKELKHIL 140

  Fly   144 GLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLK 178
            .|.:..:|.|.||:..|.:|:||.|.::.:::.||
 Frog   141 KLENYDDRPWEIQSCSAYTGEGLAEAMNAVASLLK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 80/165 (48%)
arl11XP_002935781.1 P-loop_NTPase 15..173 CDD:422963 76/157 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.