DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf79F and trim23

DIOPT Version :9

Sequence 1:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_002934252.2 Gene:trim23 / 100490191 XenbaseID:XB-GENE-984755 Length:577 Species:Xenopus tropicalis


Alignment Length:164 Identity:102/164 - (62%)
Similarity:129/164 - (78%) Gaps:1/164 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWR 79
            |.|:|::.:|||.|||||||:|||..|.:..|||||||||||||||:.||:|||||:.|:||||:
 Frog   405 KMEIRVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWK 469

  Fly    80 HYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLG 144
            ||:.|||.::||:||:.|||:.||..||.::|.|.|||||:|||||||||:..|::..|:|:.|.
 Frog   470 HYYLNTQAVVFVIDSSHRERVTEAHSELSKLLTEKELRDALLLIFANKQDVTGALSVEEMTELLS 534

  Fly   145 LHSL-RNRNWYIQATCATSGDGLYEGLDWLSNQL 177
            ||.| ..|:||||...|.||.|||:||||||.||
 Frog   535 LHKLCCGRSWYIQGCDARSGMGLYDGLDWLSRQL 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 102/164 (62%)
trim23XP_002934252.2 mRING-HC-C3HC3D_TRIM23_C-IX 31..80 CDD:319559
modified RING-HC finger (C3HC3D-type) 34..78 CDD:319559
Bbox2_TRIM23_C-IX_rpt1 126..175 CDD:380831
Bbox2_TRIM23_C-IX_rpt2 177..226 CDD:380832
BBC 229..373 CDD:128778
ARD1 409..577 CDD:206723 100/160 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.