DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC4 and AT5G10780

DIOPT Version :9

Sequence 1:NP_001303388.1 Gene:EMC4 / 40505 FlyBaseID:FBgn0037199 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001078568.1 Gene:AT5G10780 / 830945 AraportID:AT5G10780 Length:187 Species:Arabidopsis thaliana


Alignment Length:165 Identity:49/165 - (29%)
Similarity:87/165 - (52%) Gaps:21/165 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KWALDFNGS----KNADIPSPLGYNPSALVNQSEVVRDQR------LVIKKSWDLALGPLKNIPM 65
            :||::|:..    .:.||..|.|::.::..........|:      ..::|:|::|..|.||:.|
plant    13 RWAVEFSDQSTVPSSRDILDPPGFSRASQEQDDSANSRQKKDAEATWKLQKAWEVAQSPFKNLMM 77

  Fly    66 NLFIMYMSGNSISIFPIMMVGMMLIRPIKAIFTTQVTSKMAEGAQGTG-----QRIVYFLGNLAN 125
            ..|:|:|:||::.:|.|.:....|.:||.|:   |...|:.|..:...     .::|:...||..
plant    78 MGFMMWMAGNTVHLFSIGITFSALWQPISAL---QSVGKIFEPFKDNKVELLMPKLVFLALNLGG 139

  Fly   126 VALALYKCQSMGLLPTHASDWLAFVQP---QTRLE 157
            :||.::|..::||||||||||::.:.|   .||.|
plant   140 LALGVWKLNTLGLLPTHASDWVSSLPPPQLNTRAE 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC4NP_001303388.1 DUF1077 43..152 CDD:283955 38/119 (32%)
AT5G10780NP_001078568.1 DUF1077 51..166 CDD:283955 38/117 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I3378
eggNOG 1 0.900 - - E1_KOG3318
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5879
Inparanoid 1 1.050 76 1.000 Inparanoid score I2418
OMA 1 1.010 - - QHG54843
OrthoDB 1 1.010 - - D1623701at2759
OrthoFinder 1 1.000 - - FOG0004297
OrthoInspector 1 1.000 - - oto3267
orthoMCL 1 0.900 - - OOG6_102320
Panther 1 1.100 - - LDO PTHR19315
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.