DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC4 and EMC4

DIOPT Version :9

Sequence 1:NP_001303388.1 Gene:EMC4 / 40505 FlyBaseID:FBgn0037199 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_057538.1 Gene:EMC4 / 51234 HGNCID:28032 Length:183 Species:Homo sapiens


Alignment Length:169 Identity:87/169 - (51%)
Similarity:112/169 - (66%) Gaps:13/169 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KKLKWALDFN------------GSKNADIPSPLGYNPSALVNQSEVVRDQRLVIKKSWDLALGPL 60
            ::.|||::.:            ||...|...|:||....:.:.|....|:.||.|:.||:|||||
Human    13 RRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPL 77

  Fly    61 KNIPMNLFIMYMSGNSISIFPIMMVGMMLIRPIKAIFTTQVTSKMAE-GAQGTGQRIVYFLGNLA 124
            |.||||||||||:||:|||||.|||.||..|||:|:.....|.||.| .:|...|.:||.:|||.
Human    78 KQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMAISATFKMLESSSQKFLQGLVYLIGNLM 142

  Fly   125 NVALALYKCQSMGLLPTHASDWLAFVQPQTRLEYYGGGI 163
            .:|||:|||||||||||||||||||::|..|:|:.|||:
Human   143 GLALAVYKCQSMGLLPTHASDWLAFIEPPERMEFSGGGL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC4NP_001303388.1 DUF1077 43..152 CDD:283955 71/109 (65%)
EMC4NP_057538.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39 6/30 (20%)
DUF1077 56..170 CDD:399428 73/114 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145843
Domainoid 1 1.000 145 1.000 Domainoid score I4606
eggNOG 1 0.900 - - E1_KOG3318
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5879
Inparanoid 1 1.050 166 1.000 Inparanoid score I4183
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54843
OrthoDB 1 1.010 - - D1623701at2759
OrthoFinder 1 1.000 - - FOG0004297
OrthoInspector 1 1.000 - - oto89628
orthoMCL 1 0.900 - - OOG6_102320
Panther 1 1.100 - - LDO PTHR19315
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2002
SonicParanoid 1 1.000 - - X4099
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.