DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC4 and emc4

DIOPT Version :9

Sequence 1:NP_001303388.1 Gene:EMC4 / 40505 FlyBaseID:FBgn0037199 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_991221.1 Gene:emc4 / 402956 ZFINID:ZDB-GENE-040426-1891 Length:189 Species:Danio rerio


Alignment Length:167 Identity:88/167 - (52%)
Similarity:115/167 - (68%) Gaps:11/167 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KKLKWALDFN----------GSKNADIPSPLGYNPSALVNQSEVVRDQRLVIKKSWDLALGPLKN 62
            |::|||::.:          ..|:.|:..|:||:...:.:.|....|:.||.|:.||:||||||.
Zfish    21 KRMKWAVELSLGNSRSRSDRQGKDGDVMYPVGYSDKPVPDTSVQEADRNLVEKRCWDVALGPLKQ 85

  Fly    63 IPMNLFIMYMSGNSISIFPIMMVGMMLIRPIKAIFTTQVTSKMAE-GAQGTGQRIVYFLGNLANV 126
            |||||||||||||:|||||||||.||..|||:|:.:...|.|:.| .:|...|.:||.:|||...
Zfish    86 IPMNLFIMYMSGNTISIFPIMMVCMMAWRPIQALMSMSATFKLLESSSQQWLQGLVYLIGNLLGS 150

  Fly   127 ALALYKCQSMGLLPTHASDWLAFVQPQTRLEYYGGGI 163
            |||:||||||||||||:||||||::|..|||..|||:
Zfish   151 ALAIYKCQSMGLLPTHSSDWLAFIEPPQRLEIMGGGM 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC4NP_001303388.1 DUF1077 43..152 CDD:283955 71/109 (65%)
emc4NP_991221.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..63 5/32 (16%)
DUF1077 62..176 CDD:283955 72/113 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579309
Domainoid 1 1.000 146 1.000 Domainoid score I4510
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5879
Inparanoid 1 1.050 171 1.000 Inparanoid score I4101
OMA 1 1.010 - - QHG54843
OrthoDB 1 1.010 - - D1623701at2759
OrthoFinder 1 1.000 - - FOG0004297
OrthoInspector 1 1.000 - - oto41348
orthoMCL 1 0.900 - - OOG6_102320
Panther 1 1.100 - - LDO PTHR19315
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2002
SonicParanoid 1 1.000 - - X4099
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.