DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC4 and emc4

DIOPT Version :9

Sequence 1:NP_001303388.1 Gene:EMC4 / 40505 FlyBaseID:FBgn0037199 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_988876.1 Gene:emc4 / 394471 XenbaseID:XB-GENE-965547 Length:180 Species:Xenopus tropicalis


Alignment Length:169 Identity:91/169 - (53%)
Similarity:116/169 - (68%) Gaps:16/169 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KKLKWALDF--NGSKN-------ADIPSPLGYNPSALVNQSEVVRDQRLVIKKSWDLALGPLKNI 63
            ::.|||::|  .||:.       .|...|:||:...:.:.|....|..||.|:.||:||||||.|
 Frog    13 RRFKWAIEFGSGGSRGRGERGGLQDSMYPVGYSDKQVPDTSVQESDHILVEKRCWDIALGPLKQI 77

  Fly    64 PMNLFIMYMSGNSISIFPIMMVGMMLIRPIKAIFTTQVTSKMAEGAQGTGQR----IVYFLGNLA 124
            |||||||||:||:|||||||||.||..|||:|:..|..|.|:.|   .:|||    :||.:|||.
 Frog    78 PMNLFIMYMAGNTISIFPIMMVCMMAWRPIQALLATPATFKLLE---SSGQRFLQGLVYLIGNLL 139

  Fly   125 NVALALYKCQSMGLLPTHASDWLAFVQPQTRLEYYGGGI 163
            .:|||:|||||||||||||||||||::|..|:||.|||:
 Frog   140 GLALAVYKCQSMGLLPTHASDWLAFIEPPERMEYTGGGL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC4NP_001303388.1 DUF1077 43..152 CDD:283955 73/112 (65%)
emc4NP_988876.1 DUF1077 53..167 CDD:368894 74/116 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I4488
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5879
Inparanoid 1 1.050 172 1.000 Inparanoid score I3981
OMA 1 1.010 - - QHG54843
OrthoDB 1 1.010 - - D1623701at2759
OrthoFinder 1 1.000 - - FOG0004297
OrthoInspector 1 1.000 - - oto103452
Panther 1 1.100 - - LDO PTHR19315
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2002
SonicParanoid 1 1.000 - - X4099
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.