DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC4 and emc4

DIOPT Version :9

Sequence 1:NP_001303388.1 Gene:EMC4 / 40505 FlyBaseID:FBgn0037199 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_588167.1 Gene:emc4 / 2539075 PomBaseID:SPCC1281.03c Length:193 Species:Schizosaccharomyces pombe


Alignment Length:172 Identity:63/172 - (36%)
Similarity:89/172 - (51%) Gaps:42/172 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNPKKLKWALDFNGSKNAD-IPSPLGYNPSALVN------------------QSEVVRDQRLVIK 50
            :.|||:   :|     |:| .|:|.|:...:||:                  :.|:.:|  |::|
pombe    19 KKPKKI---VD-----NSDKFPTPRGFQQKSLVSKNIHSGNSASSTSIFAKREEELQKD--LLLK 73

  Fly    51 KSWDLALGPLKNIPMNLFIMYMSGNSISIFPIMMVGMMLIRPIKAIFTTQVTSKMAEG------- 108
            |:|:||..|||.||||..:.||||||:.||.||...|:|:.|:|||.:|.......:|       
pombe    74 KAWELAYSPLKQIPMNAILAYMSGNSLQIFSIMTTLMLLVNPLKAITSTGSAFTPFKGTHPGTLW 138

  Fly   109 -AQGTGQRIVYFLGNLANVALALYKCQSMGLLPTHASDWLAF 149
             |.|     .|.|..|..:.:.:||.|.||||||..|||||:
pombe   139 PAMG-----AYILFQLLLMGIGVYKLQRMGLLPTTTSDWLAW 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC4NP_001303388.1 DUF1077 43..152 CDD:283955 51/115 (44%)
emc4NP_588167.1 DUF1077 63..176 CDD:283955 52/120 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2044
eggNOG 1 0.900 - - E1_KOG3318
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I1731
OMA 1 1.010 - - QHG54843
OrthoFinder 1 1.000 - - FOG0004297
OrthoInspector 1 1.000 - - oto101087
orthoMCL 1 0.900 - - OOG6_102320
Panther 1 1.100 - - LDO PTHR19315
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2002
SonicParanoid 1 1.000 - - X4099
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.