DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC4 and perm-3

DIOPT Version :9

Sequence 1:NP_001303388.1 Gene:EMC4 / 40505 FlyBaseID:FBgn0037199 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_500802.1 Gene:perm-3 / 177324 WormBaseID:WBGene00022776 Length:174 Species:Caenorhabditis elegans


Alignment Length:162 Identity:70/162 - (43%)
Similarity:97/162 - (59%) Gaps:16/162 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 WALDFN-GSKN-----ADIPSPLGYNPSALVNQS-EVVRD----QRLVIKKSWDLALGPLKNIPM 65
            |.||:. .|||     ::...|..|:.:|.|..| |..|.    :.|..|:.||.|:||.|::||
 Worm     6 WKLDYTYSSKNCRTADSNFNPPGFYSTAATVQHSAEADRSADQHEHLARKRVWDTAMGPAKSLPM 70

  Fly    66 NLFIMYMSGNSISIFPIMMVGMMLIRPIKAIFTTQVTSKMAEGAQGTG----QRIVYFLGNLANV 126
            |:|:|||:|..:|||||||||||:.||:||:|....|.|..| :..||    .::::.||||..:
 Worm    71 NMFMMYMAGGGVSIFPIMMVGMMVFRPLKALFAVNSTFKPLE-SPATGSMFIHKLIFCLGNLGAI 134

  Fly   127 ALALYKCQSMGLLPTHASDWLAFVQPQTRLEY 158
            .||:||..:|||||...||||.|:....|.:|
 Worm   135 GLAIYKVHTMGLLPNTPSDWLEFIPQPGRAQY 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC4NP_001303388.1 DUF1077 43..152 CDD:283955 56/116 (48%)
perm-3NP_500802.1 DUF1077 45..159 CDD:283955 55/114 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158712
Domainoid 1 1.000 116 1.000 Domainoid score I3758
eggNOG 1 0.900 - - E1_KOG3318
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5879
Inparanoid 1 1.050 123 1.000 Inparanoid score I3309
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54843
OrthoDB 1 1.010 - - D1623701at2759
OrthoFinder 1 1.000 - - FOG0004297
OrthoInspector 1 1.000 - - oto20479
orthoMCL 1 0.900 - - OOG6_102320
Panther 1 1.100 - - LDO PTHR19315
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2002
SonicParanoid 1 1.000 - - X4099
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.