DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARNT and cyc

DIOPT Version :9

Sequence 1:NP_001659.1 Gene:ARNT / 405 HGNCID:700 Length:789 Species:Homo sapiens
Sequence 2:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster


Alignment Length:410 Identity:168/410 - (40%)
Similarity:255/410 - (62%) Gaps:35/410 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    70 DKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRM 134
            |:|:.||:.||.        .::||||||:|||:||..||.|||.|:|.|.|:.||.||||:|||
  Fly    19 DEEKSARTSDEN--------RKQNHSEIEKRRRDKMNTYINELSSMIPMCFAMQRKLDKLTVLRM 75

Human   135 AVSHMKSLRGTGNTST-DGS-YKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVL 197
            ||.|::.:||:|:... :|| |:||||:|||||.:||:|::||||:|.|:.||::||||||:.||
  Fly    76 AVQHLRGIRGSGSLHPFNGSDYRPSFLSDQELKMIILQASEGFLFVVGCDRGRILYVSDSVSSVL 140

Human   198 NQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTG-TVKKEGQQSSMRMCMGSRR 261
            |..|::..|.:.:|.:||.|:.|::||||:.|.....|::|.||. .||.:..||..|:|.|:||
  Fly   141 NSTQADLLGQSWFDVLHPKDIGKVKEQLSSLEQCPRERLIDAKTMLPVKTDVPQSLCRLCPGARR 205

Human   262 SFICRMRCGSSSVDPV------SVNRLSFVRNRCRNGLGSVKDGEPHFVVVHCTGYIKAWPPAGV 320
            ||.|||:..::|.:.:      |.:..|..:.:.|...|.      .:.|:.||||:|:|.|   
  Fly   206 SFFCRMKLRTASNNQIKEESDTSSSSRSSTKRKSRLTTGH------KYRVIQCTGYLKSWTP--- 261

Human   321 SLPDDDPEAGQGSK----FCLVAIGRL--QVTSS--PNCTDMSNVCQPTEFISRHNIEGIFTFVD 377
             :.|:|.:|....:    .|||||||:  .|.:|  |...|.....:...|||||:.||.|.|:|
  Fly   262 -IKDEDQDADSDEQTTNLSCLVAIGRIPPNVRNSTVPASLDNHPNIRHVLFISRHSGEGKFLFID 325

Human   378 HRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTS 442
            .|....:|:.|||:||.:..|:.|.||...|.:|.:.|:::..:|.:.::|||.|:..::.:::.
  Fly   326 QRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSE 390

Human   443 SFTFQNPYSDEIEYIICTNT 462
            ...|:||::.||:|||..|:
  Fly   391 WRAFKNPWTSEIDYIIAKNS 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARNTNP_001659.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..97 9/26 (35%)
DNA-binding. /evidence=ECO:0000269|PubMed:28396409 88..128 22/39 (56%)
HLH 91..143 CDD:278439 32/51 (63%)
Required for heterodimer formation with EPAS1. /evidence=ECO:0000250|UniProtKB:P53762 112..264 79/154 (51%)
Required for heterodimer formation with HIF1A. /evidence=ECO:0000250|UniProtKB:P53762 112..168 33/57 (58%)
PAS 163..269 CDD:279347 53/106 (50%)
PAS 166..230 CDD:214512 31/63 (49%)
Mediates the transcription activity and dimerization of the AHR:ARNT complex. /evidence=ECO:0000250|UniProtKB:P53762 167..171 2/3 (67%)
PAS_11 362..462 CDD:291273 37/99 (37%)
PAS 362..458 CDD:238075 35/95 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 465..492
Med3 <523..>734 CDD:288447
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 672..789
cycNP_524168.2 HLH 31..84 CDD:278439 32/52 (62%)
PAS 111..212 CDD:279347 49/100 (49%)
PAS 111..173 CDD:214512 31/61 (51%)
PAS_11 311..411 CDD:291273 38/100 (38%)
PAS 311..406 CDD:238075 35/94 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3561
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D168098at33208
OrthoFinder 1 1.000 - - FOG0000695
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.