DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11241 and Phykpl

DIOPT Version :9

Sequence 1:NP_001303389.1 Gene:CG11241 / 40492 FlyBaseID:FBgn0037186 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_006534386.1 Gene:Phykpl / 72947 MGIID:1920197 Length:486 Species:Mus musculus


Alignment Length:455 Identity:181/455 - (39%)
Similarity:253/455 - (55%) Gaps:48/455 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LKTRRNHLTPNLLAHF-KKPLVIHAGHMQWLYDHEGRRYLDMFGGI---VTVSVGHCHPKVNQAL 122
            |..||..|:.:....| :.|:.|..|..|:|||.:||.|||....:   ..::||||||.|.||.
Mouse    12 LDLRRRLLSSSCRLFFPEDPVKIIRGQGQYLYDEQGREYLDCINNVAHDAPLAVGHCHPTVVQAA 76

  Fly   123 SEQTAKLWHTTNIYMHPKIHEYAERLVAKFPGDLKSVCFVNSGSEANDLAMLMARLYTGNQDILS 187
            .||...| :|.:.|:|..|.:||:||....|..|....|:||||||||||:.:||.|||:||::.
Mouse    77 HEQNLVL-NTNSRYLHDNIVDYAQRLSETLPEQLSVFYFLNSGSEANDLALRLARQYTGHQDVVV 140

  Fly   188 LRNCYHG-------MSPYTM-GLTAHSTWRFPLPGVNSGLVHVMN-PDPYQGIWGGSNCRDSPVQ 243
            |.:.|||       :|||.. .|.....|           |||.. ||.|:|.:.    .|.|  
Mouse   141 LDHAYHGHLSSLIDISPYKFRNLGGQKEW-----------VHVAPLPDTYRGPYR----EDHP-- 188

  Fly   244 TTRKCQCTVGCQAGDAYYNELEETFKYSLPRG-KVAAMFAESIQGVGGTVQFPKGYLKRAAALVR 307
                       ...:||.||::.....:..:| |:||.||||:..|.|.:..|.||..:.|..:.
Mouse   189 -----------NPAEAYANEVKHVISSAQQKGRKIAAFFAESLPSVSGQIIPPAGYFSQVAEHIH 242

  Fly   308 ANGGLFVADEVQTGFGRTGEHFWGF--ESHDYVPDIVTMAKGIGNGFPLAAVVTTPEI--AASLS 368
            ..||||||||:|.||||.|:|||.|  |..|:|||||||.|.||||.|:|.:.||..:  |...:
Mouse   243 RAGGLFVADEIQVGFGRIGKHFWAFQLEGEDFVPDIVTMGKSIGNGHPVACMATTQAVSRAFEAT 307

  Fly   369 QALHFNTYGGNPMASAVGIAVLDVIEEEQLQRNSLEVGTYFLKGLAELQQRFEIIGDVRGKGLMI 433
            ...:|||:||||::.|||:|||||::.||||.::..||::.|:.|.:.:.:..|||||||.||.|
Mouse   308 GVEYFNTFGGNPVSCAVGLAVLDVLKTEQLQAHATNVGSFLLEHLTQQKAKHPIIGDVRGTGLFI 372

  Fly   434 GVELVGNREKRTPLATPHVLDIWEKCKDQGVLLGRGGLHGNVLSMRPPLCLCAEDVEFALETLEE 498
            ||:|:.:...||| ||.....:..:.|:..:||...|...|:|..:||:|...::.:..:..|::
Mouse   373 GVDLIKDETLRTP-ATEEAEYLVSRLKENYILLSIDGPGKNILKFKPPMCFNVDNAQHVVAKLDD 436

  Fly   499  498
            Mouse   437  436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11241NP_001303389.1 GabT 55..501 CDD:223238 181/455 (40%)
OAT_like 80..500 CDD:99735 176/436 (40%)
PhykplXP_006534386.1 PRK06148 <1..438 CDD:180426 181/455 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63788
OrthoDB 1 1.010 - - D145181at2759
OrthoFinder 1 1.000 - - FOG0000701
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.